General Information

  • ID:  hor003838
  • Uniprot ID:  P19402
  • Protein name:  Lipotropin gamma
  • Gene name:  pomc
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  ACTH and MSH are produced by the pituitary gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ELTGERPAAAPGPDGLGFGLVAEAEAEAAAAEKKDAAEKKDDGSYRMEHFRWGTPRKG
  • Length:  58(166-223)
  • Propeptide:  MPRSCYSRSGTLLLALLLQISMEVRGWCLESSQCQDLTTERHLLECLRACKPDLSAETPVFPGGADEQTPTESPRKYVTGHFRWGRFGRGNSSGASQKREEEAAAADPGFHGDGVEPGLREDKRSYSMEHFRWGKPVGKKRRPVKVYANGAEEESAEAFPLEFKRELTGERPAAAPGPDGLGFGLVAEAEAEAAAAEKKDAAEKKDDGSYRMEHFRWGTPRKGKRYGGFMTSEKSQTPLVTLFKNAIVKNAHKKG
  • Signal peptide:  MPRSCYSRSGTLLLALLLQISMEVRG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  ACTH stimulates the adrenal glands to release cortisol.; MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes.; Beta-endorphin and Met-enkephalin are endogenous opiates.; [Corticotropin]:
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Mc4r, Mc2r
  • Target Unid:   A8QXQ6, Q9Z1S9
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P19402-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003838_AF2.pdbhor003838_ESM.pdb

Physical Information

Mass: 713162 Formula: C265H412N78O87S
Absent amino acids: CINQ Common amino acids: A
pI: 4.75 Basic residues: 10
Polar residues: 12 Hydrophobic residues: 19
Hydrophobicity: -89.66 Boman Index: -13145
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 45.86
Instability Index: 1358.28 Extinction Coefficient cystines: 6990
Absorbance 280nm: 122.63

Literature

  • PubMed ID:  1662166
  • Title:  Molecular Cloning and Sequencing of a Guinea-Pig Pro-Opiomelanocortin cDNA